PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_A12G2615
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB
Protein Properties Length: 246aa    MW: 28853 Da    PI: 4.7372
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_A12G2615genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding60.14.9e-192673148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g WT+eEd  l+ +v+++G g+W+++ar  g++Rt+k+c++rw++yl
      Gh_A12G2615 26 KGQWTEEEDSMLKAYVTLHGEGHWNSVARFSGLRRTGKSCRLRWLNYL 73
                     799*******************************************97 PP

2Myb_DNA-binding49.51e-1579122146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg+ T eE++l+++++  +G++ W++Ia++++ gRt++++k++w++
      Gh_A12G2615  79 RGSITLEEQLLIIQLHSVWGNR-WSKIAEHLP-GRTDNEIKNYWRT 122
                      7889******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129425.3482177IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.6E-212176IPR009057Homeodomain-like
SuperFamilySSF466899.73E-3123120IPR009057Homeodomain-like
SMARTSM007179.4E-152575IPR001005SANT/Myb domain
PfamPF002497.6E-162673IPR001005SANT/Myb domain
CDDcd001673.04E-102973No hitNo description
Gene3DG3DSA:1.10.10.604.7E-2277127IPR009057Homeodomain-like
PROSITE profilePS5129419.74778128IPR017930Myb domain
SMARTSM007171.4E-1478126IPR001005SANT/Myb domain
PfamPF002491.9E-1479122IPR001005SANT/Myb domain
CDDcd001676.63E-1083122No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 246 aa     Download sequence    Send to blast
MEVYERGFFS ISESGHQIEE EMDVRKGQWT EEEDSMLKAY VTLHGEGHWN SVARFSGLRR  60
TGKSCRLRWL NYLRPAVRRG SITLEEQLLI IQLHSVWGNR WSKIAEHLPG RTDNEIKNYW  120
RTKVQKQAKK LECDVNSRKF RDALRYEYIP RLIEQISRAK QESPSGQLTY GNETESVQVD  180
QSLLPESSSE IQVTYGSTVA ETWGIDEQSN SNGWLGGGDY WMESEWCEEN IWFLQQQLYD  240
DEDNEI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A6e-24231284108B-MYB
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJX6094281e-103JX609428.1 Gossypium hirsutum clone NBRI_GE50656 microsatellite sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012437940.11e-173PREDICTED: transcription factor MYB108-like isoform X1
SwissprotQ9LDE19e-64MY108_ARATH; Transcription factor MYB108
TrEMBLA0A0D2U2Q31e-173A0A0D2U2Q3_G
STRINGGLYMA03G38040.11e-79(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47190.15e-70myb domain protein 2